Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD029172 [Oryza sativa subsp. indica] Chr09_2919,1341,,,1,1341, protein sequence BLAST
MAEQGAGEADAGGGEPPPAAVMTAAAEALAGQRSLPTPFLTKTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFARDLLPK
YFKHNNFSSFVRQLNTYGFRKIVPDRWEFANDCFRRGEKRLLCDIHRRKVVAAAAAAPPPPSPGMATAAAAVASGAVTVA
AAPIPMALPVTRAGSPAHSSEEQVLSSNSGSGEEHRQASGSGSAPGGGGGGSASGGDMGEENERLRRENARLTRELGHMK
KLCNNILLLMSKYAATQHVEGSAGISSIANCSGESSEAVPPPPPLPPAILDLMPSCPALATAAAAAGLAIDGEPDPSARL
FGVSIGLKRTRDDAAAAADEDGGGEDQAEHGGADVKPEAADPHPAGGGGGSSTEASPESHPWPIYRPTPMYHAVRPTCNG
PDRAGSDQDGSSSSVRSIRMPVHSLVSFTSVLGVSAKNGGDIGRKH