Plant Transcription factor database - Universität Potsdam
version: 3.0

Selaginella moellendorffii Transcription Factor Database


>37324 [Selaginella moellendorffii]  gw1.57.286.1 protein sequence BLAST
PAQPMDSSNSAPPPFLNKTYDMVEDPSTDPIVSWNPSGNGFIVWNLNEFQQQLLPKFFKHNNFSSFVRQLNTYGFRKVDP
DRWEFGNEGFLKGKKQLLKGIHRKKSASHQPPAVQQPQPQPQPSSKPACVEVGKFGLEGEIERLKRDKNVLMSELVRLRQ
QQQQTDSDLQMILQRL