Plant Transcription factor database - Universität Potsdam
version: 3.0

Chlorella sp. NC64A Transcription Factor Database


>139247 [Chlorella sp. NC64A]  IGS.gm_24_00027 protein sequence BLAST
MLLAEYIDWWQQHNQQQQQQQEEEEETRASSTLLTPGPLWYCKDWHLAAFDPQYQAYRCPSFFFDDWLNELYDAREQPQP
QHDVRTADYRFVYLGAKGTSTSLHSDVLRSFSWSANVYSHLLLDLHGRIPAWDFFAEDLEGLYPRLEEARSHIVTVVQHP
GDAIFVPSGWWHTVENVDDCISINHNWLNGHNVHWTWALLRLERRQAEEGIEDCRELCRQDRPSPFFRKLVCTS*