Plant Transcription factor database - Universität Potsdam
version: 3.0

Chlamydomonas reinhardtii Transcription Factor Database


>188711 [Chlamydomonas reinhardtii]  estExt_fgenesh2_pg.C_110254 protein sequence BLAST
MAHPLGIQPEGNMYIHDGPNIRESSLGALAVLPDALLLDILAPGGGGGLTAADLGRLALASKALYCFANLEESWKGLVLE
GSAKGKKGAGPAAVKAEQPGPNSKAAGAKGKEEADDAAPGTATAGKKVAASSSGSSSRALCLQRYLQVRGFYSDLLYQPW
FCANFEMPPDWLQPNNIDRRAGLTPEQFRVEYEIPNRPVILTDAMSGWAAMSKWSNDYLTRVFGDKDVIVGNMPMPFSTY
AAYAAANADEMPLYLFDKQFTATAPALASDYHVPEQFGEDLFGLLGETGRPDYRWLILGPARSGSSFHVDPNATSAWNAL
VWGAKKWVMFPPGVVPPGVHPSPDGADVATPVSLAEWFVNFYPECAEMKVKPVEFVARPGELLFVPHGWWHCALNLTDSC
AITQNFVSAVGLQATLSFLRSRRPEMVSGCAHENRCDLYDRFVAALRTQRPDVLATVEARQEEARAKAREANKWVDGLAV
TSCACSVRADRCSRGRVRARAAVY