Plant Transcription factor database - Universität Potsdam
version: 3.0

Coccomyxa sp. C-169 Transcription Factor Database


>27437 [Coccomyxa sp. C-169]  e_gw1.4.851.1 protein sequence BLAST
QVSWEEVEEAFWKIVEEGEESIDVIYGADLDSTQLGSGFPRVGGRMGTNEYAQAMWNLNNFPRLQGSHGSMLRHVDDSIP
GVMVPWVYMGMLFSSFAWHIEDHMFYSINYHHWGDAKRWYGIPSAAANAFETVFKKALPEKFEMQPDLLFHLTAMLSPRV
LRQHDVPVFGVLQEPGEFVITFPGAYHGGFNTGLNCAEAVNFAPADWLRFAALSLDRYRCFRKPSLLSHEWLLLKVGAPV
AREETSPDASFFVHRDLQRVIQEEREWRFKLWSQVVQEVGMDEGDTDDAECVICHLYCHESAVECDCCPRRRTCLRHASA
LCECPPPKWRIAFRHSLAELHALLSQVAQRIPEGVLWTISHPSAAPVSAFHNNFHRIAAAMSTSRRFSLSDAAAMCTCLT
SLVLYPVMCNDLTWK*