Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. japonica Transcription Factor Database


>LOC_Os03g31594.2 [Oryza sativa subsp. japonica] jmjC domain containing protein, expressed protein sequence BLAST
MEMEEAVDGKHPKRGRGRPRGRRGRGRGRGRGGRSLASPAAGPGDQGPRRRRGVVPAAAAAAGGRALRERRPAPGAYRES
GADNDDDGGGDDEHDEQNDDGAEKSDNQVVDSLNEPNRSNTGKKRGRPKKVKAEQEDSNQLSNGKHLGENNGNDEAIMMK
PSKESKKRGAGKKQEEEENNTISIEDEMCDANNKKGKKMLTGENALMCHQCQRNDKGRVIWCKSCNNKRFCEPCMKRWYP
GLSEVDFAAKCPYCRKNCNCKACLRMIGVEKPPEKKISEENQRRYAFRIVDLLLPWLKELQQEQMKEKELEGRLQGVSMD
EVKLEQADCDMDERVYCDRCKTSIVDFHRSCKACSYDLCLACCWELRKGEIPGGEEAKSVQWEERGQKYVFGNISKDEKK
RVSSKRHMETPSTETCNDMAVAGDPNNPLLLWKANSDGSIPCPPKEIGGCGASSLVLRCLLPEIMLSELEHRANKVIKRE
AFDKAINETSDQCPCFYHTSKIRTNATREAANRKGSSDNYLYCPDANNIQEDDLSHFQMHWSKGEPVIVSDALRLTSGLS
WEPLVMWRALREKKTNGDVEDEHFAVKAVDCLDWNEVEINIHMFFMGYMRGRRHPMTFWPEMLKLKDWPPSSMFDQRLPR
HGAEFITALPFPEYTDPRYGPLNLAVRLPAGVLKPDLGPKTYIAYGCYEELGRGDSVTKLHCDMSDAVNILMHTAEVSYD
TEQLDKIAKIKMKMREQDLHELFGVSESGAKGKADDEASKISCNMENKHTSNQSTKGLDINALPPDDSGSDIGDKPSFCQ
SEVESELTQCSKHNHEVNSSVKMHAGAHCTSDNQGYIDRSGFKRKDSDCSDQQKTGGALWDIFRREDSEKLQDYLRKHAS
EFRHIHCNPVKNVSHPIHDQTFYLTVEHKRKLKEEHGVEPWTFEQKLGDAVFIPAGCPHQVRNLKSCIKVALDFVSPENV
GECVKLTGEFRRLPSDHRAKEDKLEIKKIALNALKEVVNFLDPLPKGDEVVEVTKPKRKYGNRRGDLKSGEDQPIDESIE
ERKPKKRGRSKR*