Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>233468 [Populus trichocarpa]  gw1.XI.1448.1 protein sequence BLAST
LCHQCMKKERRTVVVCKKCERMYCIQCIKQWYPEMTEGQFAEQCPFCCKKCNCNVCLHSSGLIKTSKRNITNHEKVRHLH
YLIKSLLPFLEQICDEQTEEVQIEAGIGGILYFPVDIAENFCYSNERVYCNYCATSIVDFHRSCRKCAYELCLSCCREIR
KGSLSSRAEKSFWYVDRGFDYMHGGDPLPCQYQNPYDHSESLVLPWNASEDGSISCPPQELGGCGDCLLELKRILPLGWV
AELKKRAEELLGICDTEQASLTCKCNEAGEGVLRRAAFREGSEDNYLYCPASKDILEYEELFHFQKHWVKGEPVIVRDVL
EQTTRLSWEPKVMWRALCENVDSHISSKMSEVKAIDCLACCEVEINTRQFFKGYTEGRTYHNFWPEMLKLKDWPPSDKFE
NLLPRHCDEFNSALPFQEYSDPNAGILNVAVKFPADHLQPDLGPKTYIAYGTREELGRGDSVTKLHCDMSDAVNILTHTA
EVALSQEQCSAIELLKMKHRAQDEKEYLEQDKVDNPHIELDQGNDSGAALWDIFRREDVPKLEEYLRKHHREFRHNYCAP
VERVNSLVVHPIHDQCFYLTVEHKRKLKEEFGVEAWTFEQRVGEAVFIPAGCPHQVRNLQSCTKVAVDFVSPENIRECLR
LTEEFRQLPVNHRAREDKLEVT