Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>241426 [Populus trichocarpa]  gw1.XIII.1675.1 protein sequence BLAST
QVSARWHPESACKLDIEDAPVFYPTEEEFEDTLKYIASIRPKAEQYGICRIVPPPSWKPPCPLKEKTIWEGSTFATRVQR
VDKLQNRDSMRKRSTMSNHTRKKRRRCMSMAVDCGTDIGSISGSNDAGVCEAERFGFEPGPLFTLDTFQKYADDFKAQYF
RKNENTINKGGDMTTFQKTCEPTLDNIEGEYWRIVEKATEEIEVLYGADLETGVFGSGFPKTSNEVSSATNDRYTKSGWN
LNNFPRLPGSILSFESGDISGVLVPWLYIGMCFSSFCWHVEDHHLYSLNYMHWGAQKMWYGVPGKDAIKLEETMRKHLPD
LFEEQPDLLHKLVTQLSPNILRSEGVPVYRCVQNSGEFVLTFPRAYHSGFNCGFNCAEAVNVAPVDWLPHGQTAIELYCE
QRRRTSISHDKLLLGAAREAVRAHWELNLLKRNTLDNLRWKDVCGKNGILAKAFKERVETERVRRQFLCNSSPTLKMESD
FDATSERECSVCLFDLHLSAAGCHCSPDKFACLTHAKQLCSCAWGAKFFLFRYDISELNILLEALEGKLSAVYRWARLDL
GLALTSFVSKDNTQDVKLSYSPIRTATEPVRSHTPADPCRDLPGRAISSDIRMNSSGICSQIALEEEKKPPEGTPSKDVR
ASSVSHSSFQVIERDNDNLKLNQKGSSLLSTNLRTLVCLLSQEDTSYAAGLASEKCEGKKPSTLVRRINCNVEPLEFGVV
LSGKSWCNSQAIFPKGFRSRVRYISVLDPANMCYYVSEILDAGRNGPLFMVSLEHCPNEVFFHVSAARCWEMVRDRVNQE
ITKQHKSGRMNLPPLQPPGSLDGFEMFGFSSPAIVQAIEALDRNRVCTDYWDSRPYSRPQGQIPQHSQSIVNAGHSQGTH
EDQNISKAPGSQLLPVEADTILRGLFKKASPEELIALSHILSG