Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>775697 [Populus trichocarpa]  fgenesh4_pg.C_LG_XV000125 protein sequence BLAST
MFRYPKRTHEEIEIACPFCRGNCNCRVCLKEDVVVVAGDDKADANAKLQKLLYLLHKTLPLLRHIQREQNSEIYVDSRIH
GSLLTEEHVTKSLLDDDDRVYCDNCSTSIVNFHRSCPNPDCSYDLCLTCCSELRIGFKPGGLGCKTQVSDLESKCTADMS
CKFPDWRAESDGRIPCPPKELGGCGNEILTLRRIFDAKFVEEMIKSAEELTLNYQSPDIRLCEECYLCHPTSSTENGSKD
FAVRKAAYRENSDDNFLYCPNALQLGDDDFEHFQLHWMRGEPVIVRHALERTSGLSWEPMVMWRAFKGAEKIIKEEAHRV
KAIDCLDWCEVQVNIFQFFKGYLEGRSYRNGWPEMLKLKDWPPSNFFEECLPRHGAEYVSMLPFSEYTHPKSGILNMATK
LPAVLKPDLGPKTYIAYGFVEELGRGDSVTKLHCDMSDAVNILTHMTEVKVPRWQSKIIKKIQKQHEAEDMNPVCGGIQK
VTRKSGRKPRKRRRKVEKMDPELPKKDENIESDSSLERLYVQEQKLEEQKSMCQELGEFYSIVDCTEGNHTSELVYGGAV
WDIFRRQDVPKLIEYLKRHQKEFRHVSSLPVNTVIHPIHDQTFYLSEKHKRQLKEEFNVEPWTFEQHLGEAVFIPAGCPH
QVRNRQSCIKVALDFVSPENVQECIRLTEEFRLLPKTHRAKEDKLEVKKMALYAASAAVTEAKNLNSWVTEAKNLTS*