Plant Transcription factor database - Universität Potsdam
version: 3.0

Sorghum bicolor Transcription Factor Database


>4991161 [Sorghum bicolor]  fgenesh1_pg.C_chr_9000889 protein sequence BLAST
MVSSSASAEEAGPARHGEKKRMRCGGGGAVASPGPSATAVASHVRDHCSSRSFTEYIDGATTTCGMWHPGESQRPEIDDA
PIFTPTEEEFKDAIGYIASIRSQAERYGICRIIPPSSWKPPCPLKEKSFWKCTEFNTRVQQVDKLQNTEPTMKRTQPRVQ
RKRKRLRFGMTHRCPTSSADSEEKFGFQSGSDFTLDEFQKYADEFKQKYFRMKGSDEISISEIKNHMKMWEPSAEEIEGE
YWRIVVCPSDKVEVDYGADLDTATFGSGFVKLSSSDGNKQDPYGVSCWNLNNLPRLPDSVISFEDEDISGVVVPWLYVGM
CFSSFCWHVEDHFLYSLNYMHFGEPKVWYGVPGGEAVKLEESMRKNLPKLFEEQPDLLHELVTQLSPSVLKSEGVSVYRA
VQKSGEFVLTLPRAYHSGFNCGFNCAEAVNVAPVDWLPHGQCAAELYRDQHCKTSISHDKLLLKAAKEAIRQLWMNLLNC
KSGKGEYRWLNTCGKDGVLTNAIKTRVKKEGAAWEANVTLKSKKMDKDYDSNDRECFSCFYDLHLSAVSCQCTPNRFACL
NHMNLLCSCGMDRKITLFRYSMEELNTLVAALEGDPAAVCCWGQDHLGLVCQSGSLKHRKMDSCKSTEFSGLAIDANLVS
GFGGNQNQCDDLQKPAGFQQGKGVQNNCLNLNIEDPPCSSRIKEPSRHQVEPLDYGMVMIGKKWFNNQAIFPKGFRSRVT
FYNIQDPTAWCFYVSEVLDAGPLGPLFKEIEALDPHHQCLDYWLSKAASPAKELPSDSTNTPVIPM*