Plant Transcription factor database - Universität Potsdam
version: 3.0

Sorghum bicolor Transcription Factor Database


>5058138 [Sorghum bicolor]  Sb06g032880 protein sequence BLAST
MAVEEASSSGGGGEEGCGAWTREQEKAFENAVATTMGGEEDGDARWEKLAEAVEGKTPEEVRRHYELLVEDVDGIESGRV
PLPTYAADGAAEEGGGGGGGGKKGGGGGGTHGDKGSAKSAEQERRKGIAWTEDEHRLFLLGLEKYGKGDWRSISRNFVIS
RTPTQVASHAQKYFIRLNSMNRERRRSSIHDITSVNNGDASTAQGPITGQTNGQAANPGKPSKQSPQPANTPPGVDAYGT
TIGQPVGGPLVSAVGTPVTLPVSAPPHLAYGMHAPVPGAVVPGAPVNIAPMPYPMPPPSSHG*