Plant Transcription factor database - Universität Potsdam
version: 3.0

Vitis vinifera Transcription Factor Database


>GSVIVP00004199001 [Vitis vinifera]  protein sequence BLAST
MGAPKQKWTSEEEAALKAGVIKHGAGKWRTILMDPEFSTILHLRSNVDLKDKWRNMNVMASGLGSRHRAKLALKNQTTPK
HHEEAMALSTVVQSGEEILDAKPLAISRGPLRIDGPKKGITRLDSHILEAITNLKDPSGSNKTAIAMYIEEHYLAPPNFK
KLLSTKLKLLVANGKLTKVKGNYRIATSLMPPVVRRSSTMPFEEGKQKDSSKADKGDIKILTKSQIDAELVKMRSMTAHE
AAAAAARAVAEAEAAIAEAEEAAREAEEAEAEAEAAHVFAEAAFKALKCRTLRTW