Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. japonica Transcription Factor Database


>LOC_Os04g58820.1 [Oryza sativa subsp. japonica] ATOFP18/OFP18, putative, expressed protein sequence BLAST
MVRKLVASLFLGGGGGGGGGNDACSLSSSSSTASSWQWPSCTQARTLSFARHDAPASADDDDSKRRRQQEEEEDDYCVYK
TSVMNPAFFLDDHSTCRSYSSAASAVNDVVDDDDEVIIRGLRSSNRRLFFEPESTSSIVVKGRAVDADAAAFDGATAMSI
DSADPYGDFRRSMEEMVMSHMSGGGHDWGWLEEMLGWYLRANGKKTHGFIVGAFVDLVVALASSPSSATASSSAFQLPLQ
KGSQIN*