Plant Transcription factor database - Universität Potsdam
version: 3.0

Ostreococcus lucimarinus Transcription Factor Database


>9098 [Ostreococcus lucimarinus]  gwEuk.12.387.1 protein sequence BLAST
ISVLYAEDSMPTQMIVKAFLRKLGDVDVTIAADGKKALDAHKSMNSNFDLILMDCQMPVMDGLEATTRIRELDSAKSVVP
IVGVSSGVEGMSEKECRDVGMNDFVLKPLNVRKLTDVI