Plant Transcription factor database - Universität Potsdam
version: 3.0

Selaginella moellendorffii Transcription Factor Database


>430009 [Selaginella moellendorffii]  fgenesh2_pg.C_scaffold_123000006 protein sequence BLAST
MGKRPFVLVYQSGNYVWSFDSNGGVELTPKSQFQATSLRPAKWHLINQKIEPSDALGKRVLVAASPDPANVKNAYPDRQL
ARVYLYPCEFDALVKLWEEEASQLEKRASQLEMQQSCELQGCSLEETDTMMEDELKNTYEVQEREGDDANDKVIAGNLRD
EAGLIRIRVGVADTYYKWFGGVPRKLWQLEPRLLTDIELERFVDTALFKTDVGKVYRAIAAGAESDDISWMLLHLKRPQA
AGYKYLIDFASSKIKYKFTSSIPTANRHDLIVLLDSRDPGLGALGGFLFEQDVVAKVLQSPISAVLMVDDKHCTKCNSRM
DCGEGPVNWIACGVCKKWYHYLCVLETAPVPLKWRCASCEGKPGDEVLTTTRRLRLRYFRGDLKEALSNAGADAVNYVWR
PLRKKNGSYDFAILPGTLGQATTAKYHPVPFEAIKGGLAALEAWNKEYNKEDYPERLRLPELSEQAAPRIKQGSERYLSI
GFPVVFALFMVNRLECAGIMQAKVLIQTLGDEQSQLCADIPEPEDSVEKLDELAFEPIDFQAMTMQQLRMMALENGLTGY
SSLRRQQLIEKLEALAIVDEDENLEFESQYYSRVGALVS*