Plant Transcription factor database - Universität Potsdam
version: 3.0

Selaginella moellendorffii Transcription Factor Database


>93518 [Selaginella moellendorffii]  e_gw1.14.413.1 protein sequence BLAST
QLASFRIKELKDVLTRLGLPKQGKKQVLMDKVLAVLVPSEWQQHPPDGNRSSIAAQVIDDIYRKLRGSGAVELASGHRNF
SGAVSVSAGRSDEPDETENRCPCGSSLDTGTMIQCDNQACKVWQHLNCVVIPENAAEGVEPDVPSQFYCEICRINYGDPF
CVTLSQPLPAAKFYAPAALQMEGASPLHSLEKTFILSKADRENLHKPNHDLQVWCLLLNDKVPFRMHWPDCAELRVNGVV
VRVTTRAAKQLLGANGRDDGPGITACTREGTNRISLSACDARPFCMGVRIIRRLSVEQVMSLIPSAARGESFEEALARVR
RCIDGGASDAGDDDDSDLEVVADSVTMNLSCPMSGSRIHIAGRFKPCAHMGGFDLKTFVELNQRARKWQCPVCMKNYSLD
QLIIDPFFNRITHAMKDYGEDIKEVELKADGSWRPKLEGETVSRQPWRSPDGTPVLANGFHKATVKQEEGVSQGRPPLKI
GMKRAHDGSWAV