Plant Transcription factor database - Universität Potsdam
version: 3.0

Selaginella moellendorffii Transcription Factor Database


>69065 [Selaginella moellendorffii]  gw1.12.897.1 protein sequence BLAST
LYCLDCRGEALCSGCSPQHRDHHVVQIRRSSYHDVVRVSELQKVLDLGGVQTYIINSARVVFLNARPQPRHAKGVTKTCE
ICDRSLLDTFRYCSLGCKRSLGTLKLGRPSPSPSPSVSMEEAAAAARVVKSKKPPGSPMAVNSPELSPPTPPPTRTAKRR
KGTPHRAPFGSAI