Plant Transcription factor database - Universität Potsdam
version: 3.0

Ostreococcus tauri Transcription Factor Database


>23022 [Ostreococcus tauri]  estExt_fgenesh1_pm.C_Chr_13.00010031 protein sequence BLAST
MSDARTRSRGTVDIDGETLKRADRGRRGRESGDRRSETNAVAAAGEDGGERDADALRVLLATDDAHTRGMVHKMLRELGV
EVVMATNGKEVLEVLRGRPKGVAAAAEDVSVDMILLDVLMPALDGEVELVEVCKSNEALRGVPIVIMSTVDERKACGTRY
EHSGAAGFLTKPVNRTELKESLSHTRMLKSHESGSAENDGSGNDPNVGSAKSSLTKLTNGEKAAGGSGDGGSGGGGSGQG
QNDSGSDNVRLYNEGNEKSRRREAEAMDRWASREGGSGDCGSGGSGQGTGSGSGSHEGSGSGQRDSNENEKFRGLSVQLI
KAHGGATTMLELSLPEHSSEHVVVRRSNSRSAFKGFQTYLKSEKKESSVQMMSLDLTQQQHQSFYEASSMMPPADFARFY
GPIMPAGMPPPPMDLPLPPPPYIDMNQFTAAAFTSASIRPDMMDSTANPFWSVLQTAADHTQQTSSSQAAEHRAAAIRRF
LKKRKERNFDKKVRYASRQQLAASRPRLRGQFVRNAEETTTENGSNGSDGKKSNEFNASAAKGEVQGREEQYVDRHGSNT
GTSNEGSKEGSRSSSRDGSK*