Plant Transcription factor database - Universität Potsdam
version: 3.0

Chlorella sp. NC64A Transcription Factor Database


>139518 [Chlorella sp. NC64A]  IGS.gm_25_00069 protein sequence BLAST
MNCGNVTESQIIGFLYLVNNRARLQIGKVFRQALAALPEAPAGIWAHQMDDPPDTDSPQRARQCQYLYERVLHAVLRTAL
AEEAAAASEGQGEGAAELTAAQRHATVERALEDEDMQLGLITACVEVVNFAYLRSGDRAFPWVTLQLGRMHHTLELWQGC
DWIVDHTERPPEGTEGCVPGIPEEVAEYLAAIQAGVRVEEELAFIDGSAIFRRIMATGASWAGPGSSNPAEAAGAAEAAD
VDMDGSDTGSPGKGRGQQGRRRKYGGRSTVDAVLVGRFLSNLGRTAMLRTFSVCKEVLAQFPALHLACPALPERVCVVMD
VLLSEHLELVFGQHLSVCLACAIYYTVRLHGEMLPFRKITWLMAEVLPHHDEATFSRVELPPEDGTGWDGSRDYGDTRAY
YNRVFLPPFAAYDASQLFGDDLAPTPSRRLLEAPQPATRSGTAGDGGKHASEGGQEAGAAGHKQLRKQQRRPLGLVSTNS
KASAGH*