Plant Transcription factor database - Universität Potsdam
version: 3.0

Micromonas sp. RCC299 Transcription Factor Database


>64476 [Micromonas sp. RCC299]  EuGene.1500010197 protein sequence BLAST
MPAAVAARPFPHPAPVAGTAGSPADALPLRRVFQADAFEEACASRLGYDADEVKAASDILMEAAPLMVGKHVVVPDDSMN
PEQWQACAAFIAAGIRRASEHASTAASRSGGKKRPAPPAPPDAVASLTDVLRAFDVNCVDFFRALRKFMMAAAVPLNARL
KVAAKPTGRKAGGSDRRGGPASPAEAPNDDASCDDAGLQRSPGSNAENDVTNGGEGLNELEALLSVSELRTSFAFTKVAA
QKYRQFLDVHFDVAAPGGVDLARLGWKLYLAAKHSLLPKFPDLYSCYHLLVVVQAFLLVNAPRGLTRTELRNMVSMSVKD
DAGDVDALASLSVTSKTKLPLLRSTMEDFQRVIVQGLVAAELGGGVDSTRGAPTRRSSARGGGGAKAKDDPSPPSPSSSA
LQPAESPGEGLAKAGPARFPALLPDGGSSDEATRRGLAAAHAAADAAYAKACAPLGHLRLDERLYLPTDAETEADSLRVL
GDIKKPAAVGGSGGVAATPGPGKNLDGVHGGTQPGGVPGTPWRLTSAARSLLTGRSPARLGTPYGAPGSARLPGGTGSTA
AANGGGVVGGGQTTAGPRTPAVPFTPISEAMASAAWLHAIVAPPSPNGTPKRPSGQLEPTQRLARFVSDEVAKKLMDSVH
NLAGKTSAALREDAFLVTINGVGLLAGQGHNVSLDNLVKRRQEEAVRVFAYFLELILENEQRHVIRQAEAAKPPAKPPAK
TASPTAERRGSVADIAAIAAEQKEDALLPPPPPTAAQRAGFEALLGSGRFVRSVLACSMEVVVASYKTATLKFPAIPRLL
GLDAFDVSSIIEPFVRADTTMPREVKKHFNALEETIMETLAWSKGSSLFGFMRAAESGHLPARGPAAAALAAVSGRGQPG
AGDGPGADDPASPAPASAELAGSPDGGAQTAMRRERSFSVAAVAEAAADGEDLPGTPGGSPAGRTRRTDKGDHIAAFSTP
LKGATTPARPGQTKPRLSMGGADAEPLPKRFVRDALTLRKETPTNGRRSVDPSPNGGAASSSTSVPDPAVVNSLRVFFAK
VMRLSARRLADLCERLSLPAALTQQSYALVEHALYEHTSLLYNRHLDQVLLCAVYGACKVNKDMLLKGRTVPFREIIYQY
EKQPQCREEVFWTVILTQTDPELEVKQQGDIIEFYNKVFVPEIKAFLLSLKSRSPASAGPSPMKSPSGGPQTANAAPMSP
LPAGLQSPRVMLGGIRQNVYVSPMRSDKALASLAGTFTPRSKSLYAFLGESTHAYQSPARDLNFINRRISSSAGGNGGVD
GVGGTGVGGGTGGGNGGVADVAGEAAALPRAATGGVKRDGPPTFDEGSPGDGKPPKAPRLA*