Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>639804 [Populus trichocarpa]  grail3.0100006103 protein sequence BLAST
MTNVSSIGNGTSEEAERFWFAFVSYSVKRLSEKNRDDAQQKSDDPGLTLCQILRLAKLNIVDFFKELPHFIVKAGPILSN
IYGADWENRLEAKELQANFVHLSILSRHYKRACRELFLTSDASSDKQPAISNEATHVSDHHRFGWLLFLALRVHAFSRFK
DLVTCTNGLVSVLAVLIIHVPVRFRNFSFNDSQWFVRKGDKGVDLLASLCNKYDTSEEVLRKSMETTNNLIANILKKKPH
SASEYKNENLVNINPDGLIYYEDLMEESSLQSSLNILEKDYDDAIRNKAELDERVFINEEDSLLGSGSVSAGSLNITGAK
RKFDLISSPTKTITSPLSPHRSPASHANGIPGSANSKMAATPVSTAMTTAKWLRTIISPLPSKPSAQLERFLVSCDKDVT
NDVIRRAQIILEAIFPSSSLGERCVNGSLQSTNLMDNIWAEQRRLEALKLYYRVLESMCTAEAQILHATNLTSLLTNERF
HRCMLACSAELVVATYKTVTMLFPAVLERTGITAFDLSKVIESFIRHEESLPRELRRHLNSLEERLLDSMVWEKGSSLYN
SLTVARPALSAEINRLGLLAEPMPSLDAIAMHINFSSGCLPPVPSLQKHETSPGSGQNGDLRSPKRPCTDFRSVLVERNS
FTSPVKDRLLGNLKSKLPPPPLQSAFASPTRPNPGGGGETCAETGINVFFTKINKLAAVRINGMIEKLQPSQQHIRENVY
RLFQLILSHQTSLFFNRHIDQIILCCFYGVAKISKLNLTFREIIYNYRRQPHCKTLVFRSVFVDWSSARHNGRTGQDHVD
IITFYNEIFIPAAKPLLVDVGSAGTTVKASNVPEVGNNKDGQCPASPKVSPFPSLPDMSPKKVSSAHNVYVSPLRSSKMD
ALISNSSKSYYACVGESTHAYQSPSKDLNAINNRLNGNRKARGTLNLDNDVGLVSDSMVANSLGLQNGNCASTSGAALKS
EQSDS*