Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT3G20800.1 [Arabidopsis thaliana]  rcd1-like cell differentiation protein, putative  protein sequence BLAST
MANLPSSLSMGTPFGGPSTSAQNPTGAPANKDRNLASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIA
ALLQEIVSIYSVLAPPNLTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTSLGVIG
ALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGMDYICTTAERFFAVGRVLGNMVQSLVEQP
SPRLLKHIIRCYLRLSDNPRACAALASCLPDSLRDGSFSNCLREDPTARRWLQQLVHNVGVGRVPTHQGGGFEHML*