Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>805875 [Populus trichocarpa]  fgenesh4_pm.C_LG_XI000150 protein sequence BLAST
MANLPQSLSMNTPFGGPSASNPAAAAGAPANKDRKMASAEHLVLDLSNPDLRENALLELSKKRELFQDLAPLLWNSFGTI
AALLQEIVSIYPVLSPPNLSPAQSNRVCNALALLQCVASHPDTRMLFLNAHIPLYLYPFLNTTSKSRPFEYLRLTSLGVI
GALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGLDYICTTAERFFAVGRVLGNMVAALAEQ
PSSRLLKHIIRCYLRLSDNPRACHALRSCLPDMLRDATFSSCLREDPTTRRWLQQLLHNVGGNRVPGLQAGGGFDHMLVN
*