Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT1G73100.1 [Arabidopsis thaliana]  SUVH3 (SU(VAR)3-9 HOMOLOG 3)  protein sequence BLAST
MQGVPGFNTVPNPNHYDKSIVLDIKPLRSLKPVFPNGNQGPPFVGCPPFGPSSSEYSSFFPFGAQQPTHDTPDLNQTQNT
PIPSFVPPLRSYRTPTKTNGPSSSSGTKRGVGRPKGTTSVKKKEKKTVANEPNLDVQVVKKFSSDFDSGISAAEREDGNA
YLVSSVLMRFDAVRRRLSQVEFTKSATSKAAGTLMSNGVRTNMKKRVGTVPGIEVGDIFFSRIEMCLVGLHMQTMAGIDY
IISKAGSDEESLATSIVSSGRYEGEAQDPESLIYSGQGGNADKNRQASDQKLERGNLALENSLRKGNGVRVVRGEEDAAS
KTGKIYIYDGLYSISESWVEKGKSGCNTFKYKLVRQPGQPPAFGFWKSVQKWKEGLTTRPGLILPDLTSGAESKPVSLVN
DVDEDKGPAYFTYTSSLKYSETFKLTQPVIGCSCSGSCSPGNHNCSCIRKNDGDLPYLNGVILVSRRPVIYECGPTCPCH
ASCKNRVIQTGLKSRLEVFKTRNRGWGLRSWDSLRAGSFICEYAGEVKDNGNLRGNQEEDAYVFDTSRVFNSFKWNYEPE
LVDEDPSTEVPEEFNLPSPLLISAKKFGNVARFMNHSCSPNVFWQPVIREGNGESVIHIAFFAMRHIPPMAELTYDYGIS
PTSEARDESLLHGQRTCLCGSEQCRGSFG*