Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT2G23380.1 [Arabidopsis thaliana]  CLF (CURLY LEAF); transcription factor  protein sequence BLAST
MASEASPSSSATRSEPPKDSPAEERGPASKEVSEVIESLKKKLAADRCISIKKRIDENKKNLFAITQSFMRSSMERGGSC
KDGSDLLVKRQRDSPGMKSGIDESNNNRYVEDGPASSGMVQGSSVPVKISLRPIKMPDIKRLSPYTTWVFLDRNQRMTED
QSVVGRRRIYYDQTGGEALICSDSEEEAIDDEEEKRDFLEPEDYIIRMTLEQLGLSDSVLAELASFLSRSTSEIKARHGV
LMKEKEVSESGDNQAESSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIFPAEKPAPWCPPVDENLTCGANCYKT
LLKSGRFPGYGTIEGKTGTSSDGAGTKTTPTKFSSKLNGRKPKTFPSESASSNEKCALETSDSENGLQQDTNSDKVSSSP
KVKGSGRRVGRKRNKNRVAERVPRKTQKRQKKTEASDSDSIASGSCSPSDAKHKDNEDATSSSQKHVKSGNSGKSRKNGT
PAEVSNNSVKDDVPVCQSNEVASELDAPGSDESLRKEEFMGETVSRGRLATNKLWRPLEKSLFDKGVEIFGMNSCLIARN
LLSGFKSCWEVFQYMTCSENKASFFGGDGLNPDGSSKFDINGNMVNNQVRRRSRFLRRRGKVRRLKYTWKSAAYHSIRKR
ITEKKDQPCRQFNPCNCKIACGKECPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNC
WVIGGDGSLGVPSQRGDNYECRNMKLLLKQQQRVLLGISDVSGWGAFLKNSVSKHEYLGEYTGELISHKEADKRGKIYDR
ENCSFLFNLNDQFVLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWAKKP
EAPGSKKDENVTPSVGRPKKLA*