Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT2G24740.1 [Arabidopsis thaliana]  SDG21 (SET DOMAIN GROUP 21)  protein sequence BLAST
MVSTPPTLLMLFDDGDAGPSTGLVHREKSDAVNEEAHATSVPPHAPPQTLWLLDNFNIEDSYDRDAGPSTGPVHRERSDA
VNEEAHATSIPPHAPPQTLWLLDNFNIEDSYDRDAGPSTSPIDREASHEVNEDAHATSAPPHVMVSPLQNRRPFDQFNNQ
PYDASAGPSTGPGKRGRGRPKGSKNGSRKPKKPKAYDNNSTDASAGPSSGLGKRRCGRPKGLKNRSRKPKKPKADDPNSK
MVISCPDFDSRITEAERESGNQEIVDSILMRFDAVRRRLCQLNYRKDKILTASTNCMNLGVRTNMTRRIGPIPGVQVGDI
FYYWCEMCLVGLHRNTAGGIDSLLAKESGVDGPAATSVVTSGKYDNETEDLETLIYSGHGGKPCDQVLQRGNRALEASVR
RRNEVRVIRGELYNNEKVYIYDGLYLVSDCWQVTGKSGFKEYRFKLLRKPGQPPGYAIWKLVENLRNHELIDPRQGFILG
DLSFGEEGLRVPLVNEVDEEDKTIPDDFDYIRSQCYSGMTNDVNVDSQSLVQSYIHQNCTCILKNCGQLPYHDNILVCRK
PLIYECGGSCPTRMVETGLKLHLEVFKTSNCGWGLRSWDPIRAGTFICEFTGVSKTKEEVEEDDDYLFDTSRIYHSFRWN
YEPELLCEDACEQVSEDANLPTQVLISAKEKGNVGRFMNHNCWPNVFWQPIEYDDNNGHIYVRIGLFAMKHIPPMTELTY
DYGISCVEKTGEDEVIYKGKKICLCGSVKCRGSFG*