Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT3G59960.1 [Arabidopsis thaliana]  ASHH4 (HISTONE-LYSINE N-METHYLTRANSFERASE ASHH4)  protein sequence BLAST
MSSSKKGSDRNQIRKSLRKLKKQIGELEKLESPDRLNNVKPIFIKRNIYLKKKLKKKVKDHGIFCSCSLDPGSSTLCGSD
CNCGILLSSCSSSCKCSSECTNKPFQQRHIKKMKLVQTEKCGYGIVADEDINSGEFIIEYVGEVIDDKICEERLWKLNHK
VETNFYLCQINWNMVIDATHKGNKSRYINHSCSPNTEMQKWIIDGETRIGIFATRFINKGEQLTYDYQFVQFGADQDCYC
GAVCCRKKLGAKPCKTKNTTLEEAVKPVACKVTWKTPKLLNSEVRETNLDASGQAWNNHSQRKICCRDCIGAYYTAQMKV
LTLVVDIFQVMYEDGVTEIIDMCREVWKVVTA*