Plant Transcription factor database - Universität Potsdam
version: 3.0

Micromonas pusilla CCMP1545 Transcription Factor Database


>49889 [Micromonas pusilla CCMP1545]  EuGene.0000010113 protein sequence BLAST
MRALAPARAAPPARRERASSSSRPMRTKTTTSSSRGAVASASASASASAASTHDALAAWVTRHGGDVAAVVVRDGYRGRG
LFAARDVAAGDVVMSVPLAAALNDGVAAPPYDGAPWSVTLAAAILAERRIGDASRWAPYVRSLPTDVVGFANDEGLFDDA
SCGASSSSSSSSSQLAAEARALASHDAAAADELDRYRSLLTRSHAALTSAGRAPAPPTFAEWRWAMSMVHSRTFRLEEPA
AGVAGFETRRVMVPYVDLLNHDSRADVWQCEWDCEWDLGGGGGTFVVTATRDVRAGEEVLVSYGERCDRHFFLFFGFLPA
PNPHNTVALFANAREAAAWYEALCDDGEEVRDAWARLRADAVRTVRKEEKSRAAAAAAAAAAKRNGDDASDDADVEADAS
DTSEEEEEEEEEEDDDDDDETPRGAWTSKDAEAEEAAALCVGEDAVVDERLTRLFELLSGCDDVAVAAVRVRAREMLTAF
GGDEEEEEEEEKEEEDSAEVSEAVALARGYRARRKALLSDVA*