Plant Transcription factor database - Universität Potsdam
version: 3.0

Micromonas pusilla CCMP1545 Transcription Factor Database


>56583 [Micromonas pusilla CCMP1545]  EuGene.0000030737 protein sequence BLAST
MGKRKAEARDAYVIVSAERPPPPSHELSPAEKAYVKWMKRRGIVLNGVGVGRFPRTGRGCVATRDIAPGDVLVSVPEDAI
ITAETSVAADALTKFGLGGDEMSAEASPRLEREALVLAVLAEMSRGHESDFAPYLAALPTLRATHSPLAWSGAELAELEG
TSALDHLMQMEDEALELPSMTAEHWRHVARPFLEANPEFARAPGGVRRRRDAGEDDDDIDDEEGDEADDDEADAEVLEAQ
KMYLHAAALVAGFSFTLGGDDDDDDDDASDSEGGGGGGGGGTTQAMVPFWDMLNHASPLDASVRLTHDPDARELRMVATK
RVPAGAEVFNTYGPLGDAELLRRYGFTLRKNPHGGGVECGVRELMAAASMARYTAETAEIHRFADDPEDRDADDDADDSD
EDSDEDSESDSDSDSDDDDEDDETDDEYDLGIGEVSRKDMMDRLRWLRRRGILSNSRDKFYVSRTGRPSVALRHAVRVLS
MHRFQFGVLRAADAYERGERDDQTGAYSDEDDEDDEDGFGGAKPMTTSQIWDGAGVDDDDSDLEERQDQMSRVAVALVAL
AETALTVGRFPTASLRVDVKRLKQLGPERAGERARAGLGGWRAGIKSGAVKRAESGDHKPSWRDEERRAMHRARMALVVR
IREKRALKAMAAWARHPCRSEEDLLPPLRSSDVVERKAGSKVRGACCERDCEREGRTCEAN*