Plant Transcription factor database - Universität Potsdam
version: 3.0

Micromonas sp. RCC299 Transcription Factor Database


>58534 [Micromonas sp. RCC299]  EuGene.0500010267 protein sequence BLAST
MKEKRKSSTGDAATPKSGGAKTPNKKVKAAADAEDDSADVPLNDTEIAYLAWMKKKGVKLNGVSIGRFPHTGRGCVATRD
IKEGDVLVEVPEAAIITADGSVAGSALVAFGLGGEALLHEYSPRLEREALVLAVMAEMSRGEESEFAPYLAALPTLRATH
SPLGWSGAELSELEGTSALNRMTSAEDESLELPSMTADHWKHVARPFLQRNPEFARMPGAGADDDDHDDEDDDAAEENAR
RMYLHATALVAGFSFTLGEDDDSVEDADAAAAADDDSDSQVSTGGDTVQAMVPFWDMLNHVEPESSSVRLDHDEDANTLR
MIAIRPHAKGEEVFNTYGAAGDAELLRRYGFVMRRNPHGGGVEVSTAECLAAAEFARFESDMHEDDDSESDYSDEDDEDD
DSEDRFDGKMPPISDSDDDDDDDDDEEEEEVDSEEDEEDGEEEDAEGDSDDEDLMAMDFRPGQIAREETLERLRMLRRWG
ILRNSKQTFEVSRTGKPSLALRYVARVLSMNRFQFRRLLAADAYERGERDDQEGAYSDEEDEDDDGFGDYKPLTVEQVWN
GDTVLTDEGDDDVSEDEDEELQEREDQMGRVSVTLIALAERALTGGRYPTDSLRADMIKLKRLGAEAPGEREHAGLGGWR
GAVGAKEDSRRVGDILFPPSWRDEERRAMHRQRMALVVRIREKRALVALKRWAANPCRTEDDILPPLLRADAEEDVDATL
CRVIPKDD*