Plant Transcription factor database - Universität Potsdam
version: 3.0

Ostreococcus lucimarinus Transcription Factor Database


>5572 [Ostreococcus lucimarinus]  gwEuk.13.266.1 protein sequence BLAST
KPPPFERIHRSVFVSRPPPVKLHKSETAVCDCHPPPSRGDSETIRDGCGQECLNRKLRFSCDSRTCPCGDACSNRPLSQL
PAPKTKIIRTENRGWGLTLQEPVRAGTFIVEYAGEILDEHECAERLWYDKQSGEENFYLMEISANYVIDAKFKGSIARFI
NSSCHPNCETQRWVDASTNETRVGIFATEDIASGTELTYDYNFAHFGDEKGTSFVCMCGHPKCRGTL