Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD019262 [Oryza sativa subsp. indica] Chr06_273,3114,,,1,3114, protein sequence BLAST
MAAAGGGGDAKYNSYKAAGLRGAILEAAHVSCLEDRYALGPQLGWGQFGVIRSCSDMVTGEALACKSIAKDRLVSPDDVR
GVKLEIEVMARLSGHPNVVDLKAVYEDEASVHLVMELCAGGELFHRLEERGCFSEHEAAALFRYLMEVVAHCHSKGIVHR
DLKPENILLVSKSPSSPIKLADFGLATYIQPGRSLSGMVGSPFYIAPEVLAGGYNEAADVWSAGVILYILLSGIPPFWGK
TKSKIFECIRSTELRFPSDPWDKVSDSAKELITEMLRRDPRQRLTAKQVLEHSWIQDHADQSQDSCGHCHEINLRGEDAG
SCSFSTPLASCSRDVSFNTGGPVACQSMSEEACSPTFACRSSFSAFVAENAPSCALSGFSFGGVCEPCNAVFPSPVASMP
SFSFFCGQEPGEPESSPDGDALGEKAHCDATVVALVSSSAPRTAEVLRAAVRANPSRAIGMNSRRNHTIGAGEREHLDVA
VAESVIRWASCTNLSTTHSLRASLANGADLRGCTIRRCGREGYGVFSTAAEAGATDEVVMVVPLDLAITPMRVLQDPLVG
PRCRALFEEGGVDDRLLVMLFLMVERLRPSSLWKPYLDMLPSTFGSSIWFTEDELAELEGTTLHRATVMQRKSLQTLFDN
KVKGLVGELLNVDESGSSIEVRFEDFLWANSIFWTRALNIPLPRFYVFPESLDEKRANIGDDCGDSSLSAPQGTGTAITA
KNISGNDNPKSSNTESIWVEGLVPGIDFCNHNVKALATWEVDSMGHVTGCPSSMYLVLADKSFVKAETEICINYGNKGNE
ELLYLYGFVIDNNPDDYLMIHYPVEALRQVQSADIKMKLLEIQNAELRCLLPRSLLENGFFGSCSGENKENKNNTSPFSS
YSWSGQRKVPSYIEKIVFSQEFISTLRTIALQEHELEHTASLLGEIGSNEDRDDELRSAIWEVSGDNGALSLLVDLLRVK
MTELEEGTGTEASDSQLLEKFDLSDSEDATRSDESNETKSKVNIRTCIVYRRGQKQLTKLFLREAEHLLELSSKEEN