Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD027445 [Oryza sativa subsp. indica] Chr08_4578,1701,,,1,1701, protein sequence BLAST
MASPPPPPRLLTPKPEPDAPLPPLPYPDPNLVQSMLFSAQSPQAQPQCCLPPHIQPPASASAEAPSGDEKNNKKKKRARA
SQEMVRITNLSIADHLHYRSLVRRARLTFEALRAIYQRQDLATAGGIRNRFDLRASSKMLSKGLWMHRDIRTVGSIPGLL
VGDSFFYRAELCVLGLHTAPQAGIGYIPASIVDHGGRLRNRLDHSADQTLQRGNLALHYSCHYGIEVRVIRGHACDHSPS
SKVYVYDGLYRVVTSTFGPGKSGRDVCKFKLVRIPGQDDLGSKAWHTAAELKDALDSKIRPPKYISLDIAKGKEPFRVPL
YNKLDDDRSPLFYDYIACPDFPTTQQLLKRQTQRGCHCAELCGSRCSCERKNRGADGPVYTSDGILLRGRPLVYECGPLC
GCPMTCPNRVTQQGMKHRLEVFRSKETGWGVRTLDLIQPGAFICEYAGDVLSLDSHSGDAPLPPMEDGSSIIDPTKFPER
WREWGDASVVYPDRVPHFPLFAGARYRLDVSQRRNVACYISHSCSPNVFLQYVIRGNEDESYPHMMVFAMETIPPMRDLS
IDYGLD