Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD028001 [Oryza sativa subsp. indica] Chr09_1091,705,,,1,705, protein sequence BLAST
MKRQGDTNFYLCEVSSNMVIDATNKGNMSRFINHSCEPNTEMQKWTVEGETRVGIFALRDIKTGEELTYDYKFVQFGADQ
DCHCGSSNCRKMLGITKPVNSIVLHNGNLSQDQHVRKKRKTYLENCIGEIVRLWHRRHSMYLAASIYDFNERNGIHTLLF
TDATIEEFDLTEEDWDFLPDPDGPEEVFVSIEVHLVMLVKIVGWSYLNHKIFRLSIKLADLLSAATLHARVKCN