Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD028264 [Oryza sativa subsp. indica] Chr09_1524,3603,,,1,3603, protein sequence BLAST
MGGVEPPPPPAPAPAGLAAWLVARGVKRRAVSAKRSWPPLCGRFPAPPPPPPTAPVAGDDGSKGVEGVVANQGGAEGVAV
SPDRSVPLSGSPTAASSLPPPPSIIAGDVGDNSVEGRGDVGDKGVHGVTEGNEEEQVASAAVSSAACNGALSHGPSQPEA
ERMEVDEGEGRETGEAQLPNDTDARLSDDQGMGEVLDVMPLAVAAPVSCGANVSNGSAGNVRDVASLLMDREGGKGGCEF
ERKEVTSDRDGRETESRVGVGQLERTNDVHDGGRKKRWLMSVLNPPPKRRAISAIRKFPRDCGRAASTLAESGASMEELP
LEATPISVATGGASMEDSLARTPISVQGASLVCGLDHSSEAIDGKTIEDDESSKVENRIQEFQVATNVALDDFEGAKNGS
THPNDSIAKPSPSHGFVERVNGKGSQQEKKLVARSAWDGKMVSKYEERLQKGTPETRMRDLVDVKAKKKILKSDKMNGAL
QNDARSSGDGKMKTKASSTQRGVVRSDMSLKQGDIARKVDATGKCKGGVNSLIKEATSRKHATTNGIEENDDRDLVSDRI
IVQALMAPDKCPWTRRRKSIGGSSESRTPKLKKKFGRPRKELKDTTPREEVSPEVASCKAIKHEAIEDKEDSYFEDEGNS
KASYSDGEGNSKELVRGGKALVVCGGKKELCVTLPPSAPSGTDPRSKIRNLLIKFHAACRKLVQVEEQHKGNIGRIDIEA
GKALKQNGFIKPGPIVGNVAGVEVGDEFNFRIELSFVGLHRPYQGGIDSTKVNGILVAISIVASGGYHDELSSSDELIYT
GSGGKAIGNKAAGDQKLERGNLALKNSIETKTPVRVIHGFKGHSKGEASHSKSKQISTYIYDGLYMVVDYWKEGPEGSMV
YKYKLQRIPGQPELALHIIKATRKSKVREGVCVPDISQGRERIPIPAINTIDDTQPTAFKYTTEVIYPHSYAKEPPKGCD
CTNGCSDSNRCACAVKNGGEIPFNSNGAIVEAKPLVYECGPSCRCPPTCHNRVSQHGIKIPLEIFKTGNKGWGVRSLSSI
SSGSFVCEYAGEVLQENGDEHVETDEYLFDIGHHYHDEVWEDPKFEGILGLESSTSKTTEDTEGSKTTEDTEGSTIDASK
CSNVGRFINHSCSPNLYAQNVLWDHDDMKKPHIMFFATENIPPLQELTYDYNYGKVEDKNGKEKVKPCFCGSPDCSRRLY