Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD028528 [Oryza sativa subsp. indica] Chr09_1948,1908,,,1,1908, protein sequence BLAST
MGKDSKPKDKGKGKQAAGSSGGDDAGGGGKGGKGKGGKSADGLGTCTYVKARHVLCEKQGKINEAYKKLQDGWLDNGDKV
PPAEFAKIAQEYSECPSGKKGGDLGWFPRGKMAGPFQDVAFSTPVGATSAPFKSTVPFGLASMGTTSSSVKEGRTDQSAS
ASPPPPPAPAPPTERTRPAQRPGRQSSTAVAPTTKDAALQEFRRWVSSHGSDAGSGAAAPAAVPEVGLGLVAARDLPRGE
VLAEVPKKLWLDADAVAASDLGGAVGRGGLRPWVAVALLLLREAARGAGSPWAPYLAILPRQTDSTIFWSEEELLEIQGT
QLLSTTMGVKEYVQSEFESVEAEIISENRELFPGTVTFNDFLWAFGILRSRVFAELRGDKLALIPFADLVNHSDDITSKE
SSWEIKGKGLFGRDVVFSLRTPVNVKSGEQIYIQYDLDKSNAELALDYGFTESNSSRDAYTLTLEISESDPFYDDKLDIA
ELNGMGETAYFDIVLGESLPPQMLPYLRLLCLGGTDAFLLEALFRNAVWGHLELPVSQDNEEAICQVIRNACKSALGAYH
TTIEEDEELLGSENLQPRLQIAVEVRAGEKKVLQQIDDIFKQREEELDGLEYYQERRLKDIGLVGDNGEIIFWES