Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD033946 [Oryza sativa subsp. indica] Chr12_293,2292,,,1,2292, protein sequence BLAST
MDASALSNPRLQAMLEEEKRKAMANEFVAKLTDVCWDKCITGSIGSSFSNSEASCLSNCAKRFLELKMLTMQRVSSPSIF
QPIPEARISRLSDEFLQEFTMENSEDEAENGKLPLELEPLRSLAPKFPTILGYDVETQSTNPLLVYATPFIPCSSSQQPQ
EAPASFSLPLPKSPVPIKATPISAAFPTPQHEDESSDQDYKPFCRQKKPTLPKRAKRPQQAEKSNDANIKRRSIRRSLDN
EFNLCSSSSDNPKESVEGILMMFDSLRRRVLQLDEKEDASRRADLKAGTLMMQNNLRINNHKMIGHVPGVEVGDIFFFRI
EMCIIGLHAPAMGGIDYNSSKNKDETLAVCIISSGGYENDDDDTDILVYTGQGGNSRHKEKHDQKLERGNLALMNSKIKK
NQIRVVRSAQDPFCNSGKIYIYDGLYRIEDTWTDTAKNGFNVFKYKLRRDPGQPDGISLWKMTEKWKANPATREKAILLD
LSSKVEHLPVCLVNDVDDEKGPSHFNYVAGVKYLRPLRKTKPLQCCKCPSVCLPGDPNCSCAQQNGGDLPYSATGLLAKH
TPMVYECSSNCQCSHNCRNRITQKGIKLNFEVFWTGDRGWGLRSWDPIRAGTFICEYAGEVIDETKMDIDVEEDKYTFCA
SCPGDKALSWNLGAELLEEKSTAVTTKNFKKLPIIIRANNEGNVARFLNHSCSPNLLWQAVQYDHGDDSYPHIMFFAMEH
IPPMTELTYDYGTRGAPPGFEGKPFKACKLKSCLCGSKHCRGY