Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD036953 [Oryza sativa subsp. indica] Chr01_5653,2211,,,1,2211, protein sequence BLAST
MNRESNFMPTPDQDVLEVKPLRTLAPMFPAPLGADVLNRLTAPPLVFVAPAGQFPGGFGSLNIPAVRSFAAFGGQDASGG
KTAGGGDQDASGGKTAAGGDQDAGRGETAAFGGQETVRGEFVANGTPNVGASATGPIDATPISACKSTQPSVISLDDDDN
DDDEPYGGNQTSASGRKIKRPSHLKGYNVSDGLGTDSSNGTKKRPKTSNRKAATDNEISLMPPSSDPREVVEVLLMTFEA
LRRRHLQLDETQETSKRADLKAGAIMLASNLRANIGKRIGAVPGVEVGDIFYFRMELCIIGLHAPSMGGIDYMNKFGDED
DSVAICIVAAGVYENDDDDTDTLVYSGSGGISRNSEEKQDQKLERGNLALERSLSRKNVIRVVRGYKDPACLTGKVYIYD
GLYKIHESWKERTKTGINCFKYKLQREPGQPDAVAIWKMCQRWVENPAARGKVLHPDLSSGAENLPVCLINDVNSEKGPG
HFNYITQVKYLKPLRSMKPFQGCRCTSVCLPGDTSCDCAQHNGGDLPYSSSGLLVCRKLMVYECGESCRCSINCRNRVAQ
KGVRIHLEVFRTTNRGWGLRSWDPIRAGSFICEYVGEVVDDTKVNLDGEDDYLFRTVCPGEKTLKWNYGPELIGEHSINI
SADTFEPLPIKISAMKMGNVARFMNHSCNPNTFWQPVQFDHGEDGYPHIMFFALKHIPPMTELTYDYGDIGCESRGVGSR
AKNCLCGSSNCRGFFS