Plant Transcription factor database - Universität Potsdam
version: 3.0

Ostreococcus tauri Transcription Factor Database


>16326 [Ostreococcus tauri]  e_gw1.03.00.496.1 protein sequence BLAST
MTATYSDRLTFCKSNIHGWGLLAKTAHKAGSIVTEFKGETCRSTVADMRETAYEEEGVDCYLLKQDDDTVVDCTFQGNLA
RFTNHSCNPNMYSKIVKVDGENHIIFFARNDIKAGEELTYNYRFESEDGKVPCYCGAHNCRGYLC*