Plant Transcription factor database - Universität Potsdam
version: 3.0

Physcomitrella patens Transcription Factor Database


>168382 [Physcomitrella patens]  estExt_fgenesh1_pg.C_1740036 protein sequence BLAST
MIKDSMLLLRHTGNAGGFRIRACVGQRNAVHTAFSPLLAWLESRGETEALTSLTIGNTNQGRALLSIRHIKRGEQVLRVS
RELMITPNRLPSCVEESLSEDVNEWSRLALFQLLHKHAGKASPWEPYIRCLPPLRGLQNTVFWRDEELELLRQSNVYDQT
EHRKTLISNQFDLVQAVVNKYPELFGETVTLESFKHAYCVASSRSWGVEALGSITMVPFVDMFNHDSSARALLAYYEEEG
YAEVVADKDYNQGSQVVITYGTLPNSSLALDFGFTLPDNPHDEVQIWMEAPSGDPLRAEKLKLLRDHGIATDPFCDGTES
GGAWFGLREISSPAARGKGIPRALRTFVRVISASTTKELEAMAEDAKRRQGRLAQRPLKDGKEARALKLLLDNIEQCVSS
HRSALKKVLKAQDLPQIQAERARMAGHVLDGELRVLRSVGAWLRPRAEGGGYESLGLA*