Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>261219 [Populus trichocarpa]  gw1.XVIII.1760.1 protein sequence BLAST
YFFRIDKEHIIDATRKGGIARFVNHSCLPNCVAKVISVRNEKKVVFFAERDIYPGEEITYDYHFNNEDEGKKIPCFCNSK
NCRRYLN