Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>818400 [Populus trichocarpa]  estExt_fgenesh4_pg.C_LG_V0535 protein sequence BLAST
MASPPPSPPPSASITRSEPPKDSPMIKSNQDTTLASEEVLLVIESLKKQVAADRCIYVMKRMEENRQKLVGITNHLDKLS
KERKNNWISGTDNSIDLFTKRQNDALSMHGGIDSTNVDKDSHGSEEDGHASTAVLLGSSIPVKNAVRPIKLPEVNRLPPY
TSWVFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIIDEEEAKRYFVESEDYILRMTIKEAGSSDPVVESLAH
CFSRSPSEVKARFEVLKKEEKAVEDSKNKDIEAQTLNSFLVKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLIFLAEKQ
SPWSYPEDNITCGSHCYKLHGVIEENSICQSDGARVPISSRKKTSASSARRNVKSCQSESASSNAKNISESSDSEIGPHQ
DTSPTSQISPSKSMLVGKGGTCKRNSKRVAERVLSCMRKRQKKMVASDSDSVASGGLLSIDLKRRSTSHKGKEDASSSHK
NAKSPTIARSRRKELMNQDSHNLVQGEFHDGLSSEMVANPPVTSSDDTLRKEEFIDEHKCKKELSDDRSWKAIEKGLFEK
GVEIFGGNSCLIARNLLNGLKTCWEVFQYMTRSENRPACEAGDAGTLGEGYSKFDFNGTMVKNEARRRSRFLRRRSKVRR
LKYSWKSTAYHSFRKRITERKDQPCRQYNPCSCQTACGKQCTCLLNGTCCEKYCRCPKSCKNRFRGCHCAKSQCRSRQCP
CFAADRECDPDVCRNCWISCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGE
LISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPDPNCYAKVIMVTGDHRVGIFAKERINAGEELFY
DYRYEPDRAPAWARKPEASGSKKEDGGHSSGRAKKLA*