Plant Transcription factor database - Universität Potsdam
version: 3.0

Sorghum bicolor Transcription Factor Database


>4789504 [Sorghum bicolor]  e_gw1.2.3943.1 protein sequence BLAST
MAPLQSLPPNQDVDAVLQEYYRLASLYVSSTGSGAIVPAPAPEATAPAVVQSASGSVVKKRRPRSSDLVRVSSLGVQDQI
YFRDLVRRARITFECLRGLLLRDDERAESLGLPGVAGFGVARERRRVRADLRAAAIMADHDLWLNRDRRIVGPLPGISVG
DAFFFRMELCVLGLHGQVQAGIDYVSAGRSASGEPIATSIIVSGGYEDDDDHGDVLVYTGHGGRDPNLHKHCVDQKLEGG
NLALERSMAYGIEIRVIRAVKSRRSPVGKVYFYDGLYKVVDYWLDRGKSGFGVYKYRMLRIEGQEPMGTVNYQVAEQLKV
DVLAIRPTGYLSFDISMGRETLPVALFNDVDDDQDPLLFEYLARPIFPTSAVQGKFAEGGGGGCDCAGICSIGCNCAGRN
GGEFAYDKTGTLLRGKPLVYECGPYCRCPPSCPNRVSQKGLQHKLEVFRSRETGWGVRSLDLIKAGTFICEFSGIVLTHQ
QSEIVAANGDCLVRPSRFPPRWLDWGDISDVNPDYVAPNHPAIPELNFAIDVSRARNVACYFSHSCSPNVFVQFVLFDHY
NASYPHLMIFAMENIPPLRELSIDYGMVDEWVGQLTM*