Plant Transcription factor database - Universität Potsdam
version: 3.0

Sorghum bicolor Transcription Factor Database


>4881238 [Sorghum bicolor]  estExt_Genewise1Plus.C_chr_310826 protein sequence BLAST
MAKVDSVAPVPSPTFMDAAPLTLPPPLVVEELVLRRSARCLNRPTRPSYADQEPPKKPGGRGRGKRKRDEEKPELAAAQQ
GAKSPGRKYSKVEAGERKPMPVIAAVPVSCAGVATEDDAMGTGKSAKLRVKETLRAFNSHYLHFVQVPLFWFMFFAEFVS
ILVQEEQKRAQAALQEIEAKTKKKRPSKRPDLKAITKMQEMNAVLYPEKRIGHLPGIDVGDRFYSRAEMVVLGIHSHWLN
GIDYMGMKYQGKKEYEKLTFPLATCIVMSGIYEDDLDKADEIIYTGQGGNDLLGNHRQIGSQQLTRGNLALKNSRYNGNP
VRVIRGHLSKNSYTGKIYTYDGLYKVVHDWVQTGVQGHVVFKYKLKRLEGQPSLTTSEVRFTRAEAPTTISELPGLVCDD
ISGGQENIPIPATNLVDDPPVPPSGFTYLKSLKIPKDIKIPSSIIGCDCEGDCATNKNCSCAQRNGSDLPYVSHKNIGRL
VEPKAVVFECGANCSCNHDCVNRTSQQGLQYRLEVFKTASKGWGVRTWDTILPGAPICEYTGVLRRTEDLDGSQNNYCFD
IDCLQTMKGLDGREKRAGSEMHLPNLHPEDDSDAPPAPEYCIDASSIGNFARFINHSCQPNLFVQCVLSSHNDVKLAKVT
LFAADTILPLQELSYDYGYRLDSVVGPDGKIVKLPCHCGAPDCRKRLY*