Plant Transcription factor database - Universität Potsdam
version: 3.0

Sorghum bicolor Transcription Factor Database


>4987400 [Sorghum bicolor]  fgenesh1_pg.C_chr_7001490 protein sequence BLAST
MDMRQLHTVCNCPAAPIHEFSSFIALICWQIWKARNARISSNEAHSVDRVLRDCNLQLNSGSSDYQGKKEQQLPSGVPFL
KWLGVQQARHINPMLCKTSCSNFLVAIHLNSGSSDYQGKKEQQLPSGVPFLKWLGVQQARHINPMLCKTSCSNFLVAIHD
AGPTDDIKEAFQRLPLPYIDQEFSIDPINKQDLETESEPPPYMFILSRRKVTVMQLKVDASAVTTTQPVKVVVPAVKCSN
KPFRREKKIEIIKTQQCGWGAIALETIGKDDFVIEFVGEVIDDAMCEDRLLDMRQRRDQNFYMCKVSKDFVIDATFKGNA
CRFFNHSCQPNCRLEKWQVDGKTRLGVFASQAIKVGMPLTYNYRGFRAPYIIRHAIAQIDNSQ*