Plant Transcription factor database - Universität Potsdam
version: 3.0

Micromonas pusilla CCMP1545 Transcription Factor Database


>60763 [Micromonas pusilla CCMP1545]  EuGene.0000090314 protein sequence BLAST
MARAGTRWLLAPPLLLLLCFANEAAGGVDEGASSDAALVAARYGGTHVGGKVYVHDLLPARGPAFGGSEVTIYGENAPRP
SSRIVPRLARHHFIRLLLNSLRAGFTTNMACQFGPHTVRAHAVSPIGDRMLCVTPPYGRPGGGFTAVGLTISSLDAQLYS
SADADAARGRAVVSPRGAQGFEYTPTWITRAARPSESDANGGAVLTVVGAHLQTAGACAFGADVAGGVRLAGRAATHVVS
SALIRCEVPKREVGDGSLTLASETPEEDAARRARGWGAPALAASPTPYDPEDEVPGLALTAVRVPVVSDVTVGDASDGGG
AATITMWGAGFDVGGSSRAAATGAAAAAAASEDDADAETETRAPPRRNAGGCRVGTTWVAAATTSRVHASCVIPWRAPSA
VRVPVAYHDMRDHATGGAVVSSSSGENAFTFNPQSAPHALALVPSAAPTDGDTIVYVFGELGMGGGGVNGAGVASRSFQC
DGGGGGGGDGATSSSSSIVQLAAWTFACYASPRGPGFVAAPRASSALAQTPNAATDAVFAYARAPVVRRLSPAEGGGVGG
EPIWISGADLHLVGDTRSPSSVLCLVDDRVAVPARVVSSALASCERPRSASTGGGGSGGETRSVRYELGSHAIGFSRGGR
AFDAWPPSMTVTGVEPRAIASGGGTAVTLRGKHFASSPGAAACRFGSVGPVAASTSAADALTCVSPAAALSARGALRVYG
PVAGGVVGVEGHGVHVIRDGGDVVVGGVGVFPARASSAGAAGEEADAAADAEEDASSTAAATGGEDNNGRGSVAGAELRA
YATGATSPLEWLAGKGNVRTWCVFDASQSVGGASAAPAYAATGGAGGVACRAPLGPPGFAALRIVALGGSETTTPTHVEF
AQHPVVQRLYGPHPGEPSLVVGSPAVMDVVGGGFFHGLSCAWNGVARAPANVVSSAAARCEWSGVGVGVGVGAEVVVLGL
AAGNLGASGAFDGPVAATRKTPAVVAAIAPSTTLTRGGTSILFSGHGFVTATEGWCHIGTIGPIAATRVGVDGTRCVAPA
RAAGSTRVAVAGAVASSDISLTYVSGGGDDASADGRRNVVDVLPSRVSAEGGVASGEGVAAYADDGALAAACVLFGGGGG
GDDDATTAASDAPDAVSTPGRTWCGALPPAPAGFTVLALTTTFALAKDAARAKNRWPSRADAAAAGEIEIVASPSVSSLM
PRDAIAGVDEVLTLHGANMRRGDGAWCAFGDGAATAARALSSAVTTCELPPPPASRSVAAASAQLAPVRRRVDLTPTRRA
GASTPCTDADVGAGASCVAFKHYRSPGEASSAAPASIPSDGGVDVALRGRSFPDAPKLGCRFGSVGPIAAAWENSERIAC
VAPGMAPRVGVRVGVVVGGAAPSVTVRSRLVADAAVPGVSRRDPRGASVELRYRYASPAGVGVAERDEAMTCRMAVSGAA
SKAVAATTTTTTTSGDGGFFGARCVVPPNPTGDGFDVVAIAFAAEATGVVVDAAGGVTFEYVEDAPAVSAQPSSASAEGG
GVVFVVSVPGGARGFALGADRGDGARRARCVFGGATTDARIHSSALASCETPHRATEGVAPFDVVVGEAVSGGDAVGSFA
HAPPAIVADVFPAATDWLSGAVLTLTGRGFTADGGLGCRVGTVYAIAMQWVSAGEARCATPAHAGARTSAISVASSVAEP
PPSLGRPLAVRFTVSAELMDPRGRPGGRSIEVARRATNDANAAARASLRSTSPPATASRAPASLLGRELPSDADARRCWC
VFGDALASTIVPVSSAVARCAESPDGASAIGGRAGEATSVRVGCGGGGGGDAGWLTLGVSRLPLTLTSPTVRAVRPGRVP
AIGGVAATFTGSGFYPSDGGSGAATGAGADGDGEDAAAGAGAFFSFACRFGAIGPVAARHLSPREVSCATPATMGGRWIN
VGVAPDAAVAETAWGGDGVQVYVDDALTRSALDQSSAASAASFPPGGSARGGVAFELLHVARGSPPGSGSDAAARVPPRF
VFGDASSSAVLGAWRGDAAAAVVAARCVTPRRFASGGFEAVRVSIDLGGAVRAFAAAATQFHVHADPRVLSVFPRLSWGA
EVVHVSGEHLRPGGGAPSTACVFGGGASPSRAVSSTLITCEVAAGVEGGGAKAASAKKVAASAGASREEDASAVAVAAAA
SSSATAVRPVGVCPPGSECDDDGAGDDSLWFQSVAPVEPIESDVALGWTDGGTLTRLALTAPIRAEWLECRFGTTIVPSR
PASAWEDPLAQFYGVEGALVRPSRKMDIECVSPGHAAGKVPIEVALGRSKVPSARGAVSFKYI*