Plant Transcription factor database - Universität Potsdam
version: 3.0

Micromonas sp. RCC299 Transcription Factor Database


>66240 [Micromonas sp. RCC299]  gw2.15.32.1 protein sequence BLAST
IEKEACYAIGLLASKENHQNRIADAGALPGLVALLKRYPPQMSGNVAPSVARRAADAVTNLAHENNPIKNRVRTEGGIPP
LVALLETRDAKVQRAAASALRTLAFKNNENKEQIVEEGALPMLIFMVRSGDPHIHYEAVGVIGNLVHSSNHIKRRVLDEG
ALQPVIGLLSSECNESRREAALLLGQFATTTDDTNIEYKIKIVQRGAVQPLIQMLNHTESQLREMAAFALGRLAQNKDNQ
VGICHADGLRPLLDLLDSDETNLQHNAAFALYGLADNEDNVPDIIREGTVQRLMGGELKAQPSKDCVNKTLKRLEEKVDG
RVLKYLVYLMRSSNKDEQQRIAVALAHLCSDDQQRVIFDEQGGLDILLEMYSASAGALFPLAMRDAAGALFKVSQNMKAL
LSARYPNDAVPLPATPETHLAYEHFNNPELSDIVFFSDRDGGWEFHAHKIAFTHVSDEFHQLIDQHKVADTQQGDSHMPV
RVDMSDVMQKDEFHGLMQFVYQGDIEVPEELTEENDENGVAPLAQRLLQFAHRYEMNGLKRHCEGCMEEILTHMEDPKCE
FLREFISLAGRCNADDFIRACALYTLQHHGRICKSIGDSETVLLAQQIEPHIRQHLQSTMYR