Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT2G47900.1 [Arabidopsis thaliana]  AtTLP3 (TUBBY LIKE PROTEIN 3); phosphoric diester hydrolase/ transcription factor  protein sequence BLAST
MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQDTSVPVDAFKQSCWASMPPELLRDVLMRIEQSEDTWPSRKNV
VSCAGVCRNWREIVKEIVRVPELSSKLTFPISLKQPGPRGSLVQCYIMRNRSNQTYYLYLGLNQAASNDDGKFLLAAKRF
RRPTCTDYIISLNCDDVSRGSNTYIGKLRSNFLGTKFTVYDAQPTNPGTQVTRTRSSRLLSLKQVSPRIPSGNYPVAHIS
YELNVLGSRGPRRMQCVMDAIPASAVEPGGTAPTQTELVHSNLDSFPSFSFFRSKSIRAESLPSGPSSAAQKEGLLVLKN
KAPRWHEQLQCWCLNFNGRVTVASVKNFQLVAAPENGPAGPEHENVILQFGKVGKDVFTMDYQYPISAFQAFTICLSSFD
TKIACE*