Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD003982 [Oryza sativa subsp. indica] Chr01_6154,1335,,,1,1335, protein sequence BLAST
MSFRSIVRDVRDGFGSLSRRSFEVTLASLYGLTGHHKGKTQSSLDELDDSPAIIPESRWASLPPELLREVIRRLEADEST
WPSRRNVVCFAAVCRTWREMCKETVLSPEFCGKLTFPVSIKQPGPRDGMIQCYIKRNRSKSTYHLYLCLSNVVTAEGGKF
VLAAKRHRKTTCTEYTISMVSGNISRSSRTNIGKLRSNFLGTKFIIYDTQPPYNGAVVPHVGRTSKRFNSTKVSPKVPSV
TYNIAQVSYELNVLGTRGPRRMRCMMHSIPASSVEPGGIVPGQPEQIVPRALEDSFRSTTSFSQSFRSTTSFSKSIMDPS
MDFSSARFSDISGSIMGGDDNGEIKERPLVLRNKPPRWHEQLQCWCLNFRGRVTIASVKNFQLVAAPSPPPAGAPTPSQP
GPADPEKHIYSVGYTVQAFLLESFMGDGPRRTGCLAPAPAKATA