Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD018594 [Oryza sativa subsp. indica] Chr05_4090,1110,,,1,1110, protein sequence BLAST
MALWRCSSSWLSSVSRSSGGVGGGESKVSPEIAPVSGGEGEGEEEERWSRLLPELLTEIMRRVDAGAERWPPRRDVVACA
CVCRRWRDAAVSVVRPPLECGRITFPSSLKQPGPRDAPMHCFIRRNKKNSTFYLYLSLTQALTDKGKFLLAARRFRNGAH
TEYIISYDCDDLFPGSNSYVGKLRSDFLGTKFIIYDSQPPYDGAKPSRSQSSRRFASKQINPNVSGGNYEVGQVSYKFNF
LKSRGPRRMQCNIQCPVGQSTASDPLKEKLISTSSPLALRNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLVAPAGTSDP
WGIADEETVILQFGKIEDDAFTMDYRQPLSAFQAFAICLTSFGTKLACE